PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10026463m
Common NameCARUB_v10026463mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 425aa    MW: 47569 Da    PI: 7.113
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10026463mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1053.9e-33242300159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK vk+s++prsYYrCt+ gC vkk+vers++d ++v +tYeg+H+h+
  Carubv10026463m 242 LDDGYRWRKYGQKAVKNSPYPRSYYRCTTVGCGVKKRVERSSDDSSIVMTTYEGQHTHP 300
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.2E-34227302IPR003657WRKY domain
SuperFamilySSF1182901.44E-29235302IPR003657WRKY domain
PROSITE profilePS5081132.432237302IPR003657WRKY domain
SMARTSM007743.4E-40242301IPR003657WRKY domain
PfamPF031061.1E-26243300IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
YHHLIDSIFF SLTYMEKKIE KDLHHHHHHH QQHQKEIKNT ETKIEQHQEQ KISQASSNIM  60
ANLVTSSSSD HHHHHHQLEL AAGNLSSIFG DTSSSLPFPY SYFEDHSSNN PNSFLDLLRQ  120
DHQFASSSNS SSFSFDAFPL PNNNTNPFFT DMPLPQAESS EVVNTAPTSP NSTSVSSSSN  180
EAANDNNNSI GKEVTVKDQE EGDQQQEQKG TTKPQLKAKK KNQKKAREAR FAFLTKSDID  240
NLDDGYRWRK YGQKAVKNSP YPRSYYRCTT VGCGVKKRVE RSSDDSSIVM TTYEGQHTHP  300
FPMTPRGHIG MLTSPILDHG ATTASSSSFS IPQPRYLLAQ HHQPYNMYNN NNNSLSMVNR  360
SSSDGTFVNL GPTSSSFPGF GYDMSQASTS TSSSIRDHGL LQDILPSQIR SDSINTQTNE  420
EVRK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-262353021077Probable WRKY transcription factor 4
1wj2_A1e-262353021077Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4423970.0AF442397.1 Arabidopsis thaliana WRKY transcription factor 48 (WRKY48) mRNA, complete cds.
GenBankAY0638700.0AY063870.1 Arabidopsis thaliana unknown protein (At5g49520) mRNA, complete cds.
GenBankAY0912240.0AY091224.1 Arabidopsis thaliana unknown protein (At5g49520) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280525.10.0hypothetical protein CARUB_v10026463mg, partial
SwissprotQ9FGZ40.0WRK48_ARATH; Probable WRKY transcription factor 48
TrEMBLR0GQF20.0R0GQF2_9BRAS; Uncharacterized protein (Fragment)
STRINGAT5G49520.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56242648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.11e-143WRKY DNA-binding protein 48